PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_37002
Common NameKK1_037852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 294aa    MW: 32628.6 Da    PI: 6.7608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_37002genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+Wk++++  g+ R+ k+c++rw +yl
    C.cajan_37002 14 KGPWTPEEDIILVTYIQEHGPGNWKAVPSNTGLSRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.64.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w++yl
    C.cajan_37002  67 RGNFTDQEEKMIIHLQALLGNR-WAAIAAYLP-QRTDNDIKNYWNTYL 112
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.415965IPR017930Myb domain
SuperFamilySSF466897.11E-3111108IPR009057Homeodomain-like
SMARTSM007178.5E-161363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001673.78E-121661No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129420.4766116IPR017930Myb domain
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1567112IPR001005SANT/Myb domain
CDDcd001673.79E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVTYIQ EHGPGNWKAV PSNTGLSRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKMIIH LQALLGNRWA AIAAYLPQRT DNDIKNYWNT YLKKKLNKLE  120
ADIHTAKKAL SEALSPNKTL LAESNSANLF NDNKVSFYNS TKPTTQSISY ASSADNIARL  180
LKGWMKNAPK ASRAVTQNSF NNLADTACSE GTTSGGPKGS TSSVEMSETN FESLFGYESL  240
DLESSNSEFS QSLSPEATLF QDESKPDTAG IDMPFSLLEK WLLDDGSCQE KLIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-27141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-271411627128MYB TRANSFORMING PROTEIN
1mse_C6e-27141164105C-Myb DNA-Binding Domain
1msf_C6e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961951e-167BT096195.1 Soybean clone JCVI-FLGm-20D5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151227.11e-166hypothetical protein PHAVU_004G028500g
SwissprotP813921e-102MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A151RE370.0A0A151RE37_CAJCA; Myb-related protein 306 family
STRINGGLYMA13G05370.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.16e-98myb domain protein 30